PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01164g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 576aa    MW: 64388.2 Da    PI: 4.3008
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01164g01001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.94e-162058745
                              HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                    SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                              snr   +s+R++g+lKKA+ELS+LCd+++ + +fs+ gk
  Peinf101Scf01164g01001.1 20 SNRIGVYSRRKKGLLKKAHELSILCDIDIFLAMFSPGGK 58
                              788889******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-17765IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.423766IPR002100Transcription factor, MADS-box
CDDcd002663.14E-19887No hitNo description
SuperFamilySSF554551.44E-18988IPR002100Transcription factor, MADS-box
PfamPF003192.9E-142062IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-92843IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-94364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MVDTVRMGRA KLKLHKLDGS NRIGVYSRRK KGLLKKAHEL SILCDIDIFL AMFSPGGKPS  60
VYKSENSFED MVAKFAEVNP EERAKRDLTM EDINFLSHSL RIRLSDIEGR LRLWKNLDKI  120
DSIQQLRKME DSISKSLNEI AKHKYGVGSS TFGAGQDFQP SSVQHGIDIS SNFDARKELH  180
PCSSFHGCDS EMETYEDLNS FDSSLVYDTE QDFQASSLLQ HGMNVGQELY QCSSVHGGKS  240
EYMDACNAFN SFPQGYLEEP SFSFESYTNL VGNKEIEVSK PESENFVPDE VFLDCQLNQD  300
YIGTEFCFTF DVPQLEQMDD KGNAFDYSIN KDSGLPQSNF HDTPKSSSGT NCDNMILADS  360
INFLVHPCET SFAFQYGMDS LSSDAGEELS SSSSINRGTN LPSTQLDPCL SLHGADSENM  420
VGYKDLNVFD PSLKFDIEQE FQSSSSIQYE MNSPVSFHDG QEPHRSSSVH GCDSESVTGY  480
EDLNSFVQGF LEDPSLSFES STELACNHDI ENFKPGCGNC SPDKMFLDCQ LNQEDIQIAF  540
RSTFDLPLAE KMDVQESTFD SLNKGFGLPQ LTSIIV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499254.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499255.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499257.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499258.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499259.10.0PREDICTED: uncharacterized protein LOC107817880
TrEMBLQ84KS10.0Q84KS1_TOBAC; MADS box protein
STRINGSolyc11g045310.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1394878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-33AGAMOUS-like 30